PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_02496
Common NameKK1_002559
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 338aa    MW: 38218.4 Da    PI: 5.0983
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_02496genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWTteEde+l ++++  G g+W++ ++  g+ R++k+c++rw +yl
    C.cajan_02496 14 KGRWTTEEDEILSKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding52.98.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+  +v+++  +G++ W++Ia++++ gRt++++k++w+++l
    C.cajan_02496  67 RGNITAEEENTIVKLHSSFGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-21564IPR009057Homeodomain-like
PROSITE profilePS5129416.081961IPR017930Myb domain
SuperFamilySSF466897.19E-2811108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002493.4E-141461IPR001005SANT/Myb domain
CDDcd001679.41E-81661No hitNo description
PROSITE profilePS5129425.71162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002495.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.01E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTTE EDEILSKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI TAEEENTIVK LHSSFGNRWS LIASHLPGRT DNEIKNYWNS HLSRKIYSFP  120
KQAGAVVMDT AKAATLIPPK RKGGRTSRWA MKRNKSYTQN DTPQRPTQSF TQHNNDTAAV  180
PPLEADVAEV GERRREVVEG VEESSDDDIL GLRKMEGINE GSGALGFSDV LETCGVRNLS  240
EERDVMGVTC HNKMASSESS VNGDSGGEWY SCSSTTLASE ESWDWESVIE FNKISESEAY  300
DWEHQEKLLT WLWEDDDWET DCKTNSQMQN DMVAWFLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-23121162105MYB PROTO-ONCOGENE PROTEIN
1msf_C3e-23121162105C-Myb DNA-Binding Domain
1mse_C3e-23121162105C-Myb DNA-Binding Domain
1h8a_C3e-231211625128MYB TRANSFORMING PROTEIN
1h89_C8e-231211656159MYB PROTO-ONCOGENE PROTEIN
1h88_C8e-231211656159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0934631e-155BT093463.1 Soybean clone JCVI-FLGm-17G16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001276129.11e-149uncharacterized protein LOC100793350
TrEMBLA0A151SNJ70.0A0A151SNJ7_CAJCA; Transcription factor MYB12
STRINGGLYMA02G01740.11e-139(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-78myb domain protein 12